Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | ESAT-6-like protein EsxB(esxB) |
|---|---|
| Uniprot ID | P9WNK5 |
| Uniprot link | https://www.uniprot.org/uniprot/P9WNK5 |
| Expression system | Prokaryotic expression |
| Sequence | MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMAEMKTDAATLA QEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQ ALSSQMGF |
| Molecular weight | 37.27kDa |
| Purity estimated | >70% by SDS-PAGE |
| Buffer | TBS pH8.0 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Phe100 |
| Aliases /Synonyms | cfp10, lhp,10 kDa culture filtrate antigen CFP-10,CFP-10,Secreted antigenic protein MTSA-10 |
| Reference | PX-P4332 |
| Note | For research use only |
The ESAT6 antigen of Mycobacterium tuberculosis is the main target of the cellular environmental immunity of tuberculosis (TB) cells in the early stage of patients with tuberculosis (TB) and of several animal models. ESAT6 was not found in Mycobacterium bovis BCG. Its function is unknown, but it causes high levels of IFNγ in effector memory cells in the first stage of a protective immune response.
Send us a message from the form below
Reviews
There are no reviews yet.