Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

ESAT-6-like protein EsxB(esxB)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P9WNK5
Molecular weight:
37.27kDa

$217.00

50ug + 217 loyalty points
Met1–Phe100
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

ESAT-6-like protein EsxB(esxB)

Product name ESAT-6-like protein EsxB(esxB)
Uniprot ID P9WNK5
Uniprot link https://www.uniprot.org/uniprot/P9WNK5
Expression system Prokaryotic expression
Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMAEMKTDAATLA QEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQ ALSSQMGF
Molecular weight 37.27kDa
Purity estimated >70% by SDS-PAGE
Buffer TBS pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe100
Aliases /Synonyms cfp10, lhp,10 kDa culture filtrate antigen CFP-10,CFP-10,Secreted antigenic protein MTSA-10
Reference PX-P4332
Note For research use only
Molecular Constructor
Met1–Phe100
Product name ESAT-6-like protein EsxB(esxB)
Uniprot ID P9WNK5
Uniprot link https://www.uniprot.org/uniprot/P9WNK5
Expression system Prokaryotic expression
Sequence MGPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPMAEMKTDAATLA QEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQ ALSSQMGF
Molecular weight 37.27kDa
Purity estimated >70% by SDS-PAGE
Buffer TBS pH8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Phe100
Aliases /Synonyms cfp10, lhp,10 kDa culture filtrate antigen CFP-10,CFP-10,Secreted antigenic protein MTSA-10
Reference PX-P4332
Note For research use only
Molecular Constructor
Met1–Phe100

General information on ESAT-6-like protein EsxB (esxB):

The ESAT6 antigen of Mycobacterium tuberculosis is the main target of the cellular environmental immunity of tuberculosis (TB) cells in the early stage of patients with tuberculosis (TB) and of several animal models. ESAT6 was not found in Mycobacterium bovis BCG. Its function is unknown, but it causes high levels of IFNγ in effector memory cells in the first stage of a protective immune response.

There are no reviews yet.

Be the first to review “ESAT-6-like protein EsxB(esxB)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products