Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Outer membrane virulence protein YopE (yopE)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P31492
Molecular weight:
24.14kDa

$469.00

100ug + 469 loyalty points
Met12–Met230
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Outer membrane virulence protein YopE (yopE)

Product name Outer membrane virulence protein YopE (yopE)
Uniprot ID P31492
Uniprot link https://www.uniprot.org/uniprot/P31492
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHS VIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQ CQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Molecular weight 24.14kDa
Purity estimated 41% by SDS-PAGE
Buffer 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Met230
Aliases /Synonyms Outer membrane virulence protein YopE, YopE
Reference PX-P4378
Note For research use only
Molecular Constructor
Met12–Met230
Product name Outer membrane virulence protein YopE (yopE)
Uniprot ID P31492
Uniprot link https://www.uniprot.org/uniprot/P31492
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGMKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHS VIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQ CQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Molecular weight 24.14kDa
Purity estimated 41% by SDS-PAGE
Buffer 20 mM Tris-HCl pH8.0, 100 mM NaCl,1 mM DTT,0,1% sodium azide,0.1mM EDTA, 10% glycerol
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met12-Met230
Aliases /Synonyms Outer membrane virulence protein YopE, YopE
Reference PX-P4378
Note For research use only
Molecular Constructor
Met12–Met230

There are no reviews yet.

Be the first to review “Outer membrane virulence protein YopE (yopE)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products