Name: Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
SKU: PX-P4550-10
Availability: InStock

Product name	Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)
Uniprot ID	Q04637
Uniprot link	http://www.uniprot.org/uniprot/Q04637
Expression system	Prokaryotic expression
Sequence	ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight	23.49kDa
Purity estimated	>90% by SDS-PAGE
Buffer	50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA.
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Glu557~Lys646
Aliases /Synonyms	EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220
Reference	PX-P4550
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)”

Size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Eukaryotic translation initiation factor 4 gamma 1(EIF4G1)