Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Eukaryotic translation initiation factor 4 gamma 1(EIF4G1) |
|---|---|
| Uniprot ID | Q04637 |
| Uniprot link | http://www.uniprot.org/uniprot/Q04637 |
| Expression system | Prokaryotic expression |
| Sequence | ESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK |
| Molecular weight | 23.49kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 50 mM HEPES, pH 7.2, 100 mM KCl containing 2 mM dithiothreitol and 0.5 mM EDTA. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Glu557~Lys646 |
| Aliases /Synonyms | EIF4F, EIF4G, EIF4GI,eIF-4-gamma 1,eIF-4G 1,eIF-4G1,p220 |
| Reference | PX-P4550 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.