Name: Fibroblast growth factor 21(FGF21)(29-210)
SKU: PX-P4735-10
Availability: InStock

Product name	Fibroblast growth factor 21(FGF21)(29-210)
Uniprot ID	Q9JJN1
Uniprot link	https://www.uniprot.org/uniprot/Q9JJN1
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight	21.15kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>80%by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Ala29-Ser210
Protein Accession	Q9JJN1
Spec:Entrez GeneID	56636
Spec:NCBI Gene Aliases	Fgf8c
NCBI Reference	Q9JJN1
Aliases /Synonyms	FGF-21
Reference	PX-P4735
Note	For research use only

No Products found