Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fibroblast growth factor 21(FGF21)(29-210)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9JJN1
Molecular weight:
21.15kDa

$217.00

50ug + 217 loyalty points
His Ala29–Ser210
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fibroblast growth factor 21(FGF21)(29-210)

Product name Fibroblast Growth Factor proteins 21(FGF21)(29-210)
Uniprot ID Q9JJN1
Uniprot link https://www.uniprot.org/uniprot/Q9JJN1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight 21.15kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80%by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala29-Ser210
Protein Accession Q9JJN1
Spec:Entrez GeneID 56636
Spec:NCBI Gene Aliases Fgf8c
NCBI Reference Q9JJN1
Aliases /Synonyms FGF-21
Reference PX-P4735
Note For research use only
Molecular Constructor
His Ala29–Ser210
Product name Fibroblast Growth Factor proteins 21(FGF21)(29-210)
Uniprot ID Q9JJN1
Uniprot link https://www.uniprot.org/uniprot/Q9JJN1
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Molecular weight 21.15kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80%by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala29-Ser210
Protein Accession Q9JJN1
Spec:Entrez GeneID 56636
Spec:NCBI Gene Aliases Fgf8c
NCBI Reference Q9JJN1
Aliases /Synonyms FGF-21
Reference PX-P4735
Note For research use only
Molecular Constructor
His Ala29–Ser210

There are no reviews yet.

Be the first to review “Fibroblast growth factor 21(FGF21)(29-210)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products