Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Fibroblast growth factor 1(FGF1) (16-155)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P05230
Molecular weight:
17kDa

$250.00

50ug + 250 loyalty points
Phe16~Asp155 His
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Fibroblast growth factor 1(FGF1) (16-155)

Fibroblast growth factor 1(FGF1) (16-155)

Product name Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His
Product name Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His

There are no reviews yet.

Be the first to review “Fibroblast growth factor 1(FGF1) (16-155)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products