Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fibroblast growth factor 21(FGF21)(29-209)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9NSA1
Molecular weight:
20.61kDa

Original price was: $243.00.Current price is: $217.00.

50ug 11% OFF + 217 loyalty points
His His29–Ser209
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fibroblast growth factor 21(FGF21)(29-209)

Product name Fibroblast Growth Factor proteins 21(FGF21)(29-209)
Uniprot ID Q9NSA1
Uniprot link https://www.uniprot.org/uniprot/Q9NSA1
Expression system Prokaryotic expression
Raw Antigen Sequence HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Molecular weight 20.61kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His29-Ser209
Protein Accession Q9NSA1
Spec:Entrez GeneID 26291
Spec:SwissProtID Q8N683
NCBI Reference Q9NSA1
Aliases /Synonyms FGF-21
Reference PX-P4734
Note For research use only
Molecular Constructor
His His29–Ser209
Product name Fibroblast Growth Factor proteins 21(FGF21)(29-209)
Uniprot ID Q9NSA1
Uniprot link https://www.uniprot.org/uniprot/Q9NSA1
Expression system Prokaryotic expression
Raw Antigen Sequence HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Molecular weight 20.61kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His29-Ser209
Protein Accession Q9NSA1
Spec:Entrez GeneID 26291
Spec:SwissProtID Q8N683
NCBI Reference Q9NSA1
Aliases /Synonyms FGF-21
Reference PX-P4734
Note For research use only
Molecular Constructor
His His29–Ser209
Product name PX-P4734-1MG
Uniprot ID Q9NSA1
Uniprot link https://www.uniprot.org/uniprot/Q9NSA1
Expression system Prokaryotic expression
Raw Antigen Sequence HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Molecular weight 20.61kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His29-Ser209
Protein Accession Q9NSA1
Spec:Entrez GeneID 26291
Spec:SwissProtID Q8N683
NCBI Reference Q9NSA1
Aliases /Synonyms FGF-21
Reference PX-P4734
Note For research use only
Molecular Constructor
His His29–Ser209

Fibroblast growth factor 21(FGF21)(29-209)

There are no reviews yet.

Be the first to review “Fibroblast growth factor 21(FGF21)(29-209)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products