Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efimosfermin Biosimilar – Anti-FGF21 fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
Q9NSA1

Original price was: $298.00.Current price is: $238.00.

100ug 20% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade

Product name PX-TA2226-50
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant
Product name Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant
Product name Efimosfermin Biosimilar - Anti-FGF21 fusion protein - Research Grade
Uniprot ID Q9NSA1
Source CAS: 2765640-39-7
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-FGF21, Fibroblast growth factor 21, FGF-21
Reference PX-TA2226-100
Note For research use only. Not suitable for human use.
Isotype Fc fragment of human Ig G1 fused via peptide linker to human FGF-21 fragment-variant

Introduction

Efimosfermin Biosimilar is a therapeutic protein that is designed to target and inhibit the activity of fibroblast growth factor 21 (FGF21). This fusion protein is a biosimilar of the naturally occurring human FGF21 and has been developed for research purposes. In this article, we will explore the structure, activity, and potential applications of Efimosfermin Biosimilar.

Structure of Efimosfermin Biosimilar

Efimosfermin Biosimilar is a fusion protein composed of two parts – the FGF21 protein and the Fc region of human immunoglobulin G1 (IgG1). The FGF21 protein is a member of the fibroblast growth factor family, which plays a crucial role in regulating metabolic processes in the body. The Fc region of IgG1 is responsible for the long half-life of Efimosfermin Biosimilar, making it suitable for therapeutic applications.

The FGF21 protein in Efimosfermin Biosimilar is composed of 181 amino acids and has a molecular weight of approximately 20 kDa. It contains a signal peptide at the N-terminus, followed by a short sequence of amino acids known as the N-terminal extension. The Fc region of IgG1 is composed of two heavy chains and two light chains, connected by disulfide bonds. This structure gives Efimosfermin Biosimilar a Y-shaped appearance.

Activity of Efimosfermin Biosimilar

Efimosfermin Biosimilar acts as an anti-FGF21 agent by binding to and inhibiting the activity of FGF21. FGF21 is a hormone that is primarily produced in the liver and plays a crucial role in regulating glucose and lipid metabolism. It also has anti-inflammatory and anti-oxidant properties.

When FGF21 is overproduced, it can lead to metabolic disorders such as obesity, type 2 diabetes, and non-alcoholic fatty liver disease. Efimosfermin Biosimilar works by binding to FGF21 and preventing it from binding to its receptors on target cells. This inhibits the downstream signaling pathways of FGF21, resulting in a reduction in its activity.

Applications of Efimosfermin Biosimilar

Efimosfermin Biosimilar has potential applications in various areas of research, including metabolic disorders, inflammation, and aging. As an anti-FGF21 agent, it can be used to study the role of FGF21 in metabolic diseases and its potential as a therapeutic target. It can also be used to investigate the effects of FGF21 on inflammation and oxidative stress.

Moreover, Efimosfermin Biosimilar can be used to study the effects of FGF21 on aging. FGF21 has been shown to have anti-aging effects in animal studies, and Efimosfermin Biosimilar can be a valuable tool in understanding the underlying mechanisms.

Conclusion

In summary, Efimosfermin Biosimilar is a fusion protein designed to target and inhibit the activity of FGF21. Its structure, composed of the FGF21 protein and the Fc region of IgG1, gives it a Y-shaped appearance. By binding to FGF21, it inhibits its activity and has potential applications in various areas of research, including metabolic disorders, inflammation, and aging. Further studies and clinical trials are needed to fully understand the potential of Efimosfermin Biosimilar as a therapeutic protein and its role in treating various diseases.

There are no reviews yet.

Be the first to review “Efimosfermin Biosimilar – Anti-FGF21 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products