Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Albipagrastim Biosimilar – Anti-C17orf33 fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P09919 & P02768

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade

Product name PX-TA2222-50
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant
Product name Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant
Product name Albipagrastim Biosimilar - Anti-C17orf33 fusion protein - Research Grade
Uniprot ID P09919 & P02768
Source CAS: 2817686-50-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF, ALB, Albumin
Reference PX-TA2222-100
Note For research use only. Not suitable for human use.
Isotype Human Serum Albumin fragment 25-609 fused to Human Granulocyte Colony stimulating Factor fragment 27-200-variant

Introduction

Albipagrastim Biosimilar, also known as Anti-C17orf33 fusion protein, is a therapeutic protein that has been developed as a biosimilar to the original Albipagrastim drug. This biosimilar has been designed to have a similar structure, activity, and application as the original drug, making it a promising option for the treatment of various diseases.

Structure of Albipagrastim Biosimilar

The structure of Albipagrastim Biosimilar is based on the original Albipagrastim drug, which is a fusion protein composed of two parts – a human granulocyte colony-stimulating factor (G-CSF) and a humanized anti-C17orf33 monoclonal antibody. The G-CSF portion of the protein is responsible for stimulating the production of white blood cells, while the anti-C17orf33 antibody targets a specific protein found on the surface of cancer cells.

The Albipagrastim Biosimilar has been developed to have a highly similar structure to the original drug, ensuring that it has the same activity and efficacy. This similarity in structure also allows for a lower risk of adverse reactions or side effects, making it a safer option for patients.

Activity of Albipagrastim Biosimilar

As a therapeutic protein, Albipagrastim Biosimilar has a specific activity that is aimed at treating certain diseases. The G-CSF portion of the protein stimulates the production of white blood cells, which are essential for fighting off infections and diseases. This activity is particularly beneficial for patients undergoing chemotherapy, as it helps to prevent infections and maintain a healthy immune system.

The anti-C17orf33 antibody portion of the protein has a different activity, as it specifically targets and binds to the C17orf33 protein found on the surface of cancer cells. This binding can trigger an immune response, leading to the destruction of cancer cells. This activity makes Albipagrastim Biosimilar a potential treatment option for various types of cancer.

Application of Albipagrastim Biosimilar

Albipagrastim Biosimilar has a wide range of potential applications in the field of medicine. Its ability to stimulate the production of white blood cells makes it a valuable option for patients undergoing chemotherapy, as it can help to prevent infections and maintain their immune system. This can lead to a better quality of life for these patients and potentially improve their treatment outcomes.

The anti-C17orf33 antibody portion of the protein also makes Albipagrastim Biosimilar a potential treatment option for various types of cancer. By targeting and binding to the C17orf33 protein, the biosimilar can trigger an immune response that can lead to the destruction of cancer cells. This makes it a promising option for the treatment of solid tumors, such as breast, lung, and colon cancer.

Conclusion

In conclusion, Albipagrastim Biosimilar is a therapeutic protein that has been developed as a biosimilar to the original Albipagrastim drug. Its structure, activity, and application are based on the original drug, making it a highly similar and safe option for the treatment of various diseases. Its ability to stimulate the production of white blood cells and target cancer cells makes it a valuable treatment option for patients undergoing chemotherapy and those with certain types of cancer. Further research and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but it shows great potential in the field of medicine.

There are no reviews yet.

Be the first to review “Albipagrastim Biosimilar – Anti-C17orf33 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products