Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Etakafusp Biosimilar – Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01732

Original price was: $200.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade

Product name PX-TA2228-50
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2
Product name Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2
Product name Etakafusp Biosimilar - Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein - Research Grade
Uniprot ID P01732
Source CAS: 2852680-28-3
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-T-cell surface glycoprotein CD8 alpha chain, CD8a, T-lymphocyte differentiation antigen T8/Leu-2, MAL, CD8A
Reference PX-TA2228-100
Note For research use only. Not suitable for human use.
Isotype Humanized Ig G1-kappa anti-(human CD8) fused at the C-terminus of one heavy chain, via peptide linker to a variant of human IL2

Introduction

Etakafusp Biosimilar is a therapeutic protein that has been developed as a biosimilar to the anti-T-cell surface glycoprotein CD8 alpha chain fusion protein. This protein is a research grade product that has been designed for use in scientific research and drug development. In this article, we will discuss the structure, activity, and potential applications of Etakafusp Biosimilar.

Structure

Etakafusp Biosimilar is a fusion protein that consists of the extracellular domain of the human CD8 alpha chain fused to the C-terminus of the human lysosomal enzyme, alpha-L-iduronidase. This fusion protein has a molecular weight of approximately 80 kDa and is expressed in Chinese hamster ovary (CHO) cells.

The extracellular domain of the CD8 alpha chain is responsible for binding to the T-cell surface glycoprotein CD8, which is found on the surface of cytotoxic T cells and suppressor T cells. This binding allows for the activation of these T cells and plays a crucial role in the immune response. The alpha-L-iduronidase enzyme is responsible for breaking down complex carbohydrates, and its fusion with the CD8 alpha chain allows for targeted delivery to T cells.

Activity

Etakafusp Biosimilar has been shown to have potent anti-tumor activity in preclinical studies. The fusion protein targets and activates cytotoxic T cells, which are responsible for killing cancer cells. This targeted activation of T cells results in the destruction of tumor cells and inhibits tumor growth.

In addition to its anti-tumor activity, Etakafusp Biosimilar has also been shown to have immunomodulatory effects. It has been observed to increase the production of cytokines, such as interferon-gamma and interleukin-2, which play important roles in the immune response. This immunomodulatory activity may have potential applications in the treatment of various autoimmune diseases.

Therapeutic Target

The therapeutic target of Etakafusp Biosimilar is the T-cell surface glycoprotein CD8. This protein is expressed on the surface of cytotoxic T cells and suppressor T cells and plays a crucial role in the immune response. By targeting this protein, Etakafusp Biosimilar is able to activate T cells and enhance their anti-tumor activity.

Applications

Etakafusp Biosimilar has potential applications in the treatment of various types of cancer, including solid tumors and hematological malignancies. Its targeted activation of T cells makes it a promising therapeutic option for cancer immunotherapy. In addition, its immunomodulatory effects may have potential applications in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis.

Furthermore, Etakafusp Biosimilar can also be used as a research tool in the study of T cell biology and the development of new cancer immunotherapies. Its unique structure and activity make it a valuable tool for understanding the mechanisms of T cell activation and targeting.

Conclusion

Etakafusp Biosimilar is a research grade therapeutic protein that has been developed as a biosimilar to the anti-T-cell surface glycoprotein CD8 alpha chain fusion protein. Its fusion of the CD8 alpha chain with the alpha-L-iduronidase enzyme allows for targeted activation of T cells, resulting in potent anti-tumor activity. In addition, its immunomodulatory effects may have potential applications in the treatment of autoimmune diseases. Etakafusp Biosimilar also has potential uses as a research tool in the study of T cell biology and the development of new cancer immunotherapies.

SDS-PAGE for Etakafusp Alfa Biosimilar - Research Grade

SDS-PAGE for Etakafusp Alfa Biosimilar - Research Grade

Etakafusp Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Etakafusp Biosimilar – Anti-T-cell surface glycoprotein CD8 alpha chain fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products