Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Redalsomatropin Biosimilar – Anti-GH-N fusion protein – Research Grade

Origin species:
Human
Uniprot ID:
P01241 & P02768

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade

Product name PX-TA2234-50
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.
Product name Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.
Product name Redalsomatropin Biosimilar - Anti-GH-N fusion protein - Research Grade
Uniprot ID P01241 & P02768
Source CAS: 2793441-31-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GH-N, Pituitary growth hormone, GH1, Growth hormone, Growth hormone 1, GH, Somatotropin, ALB, Albumin
Reference PX-TA2234-100
Note For research use only. Not suitable for human use.
Isotype Human somatotropin (growth hormone (GH)) fused to human serum albumin fragment.

Introduction

Redalsomatropin Biosimilar, also known as Anti-GH-N fusion protein, is a therapeutic protein that has been developed as a biosimilar to the human growth hormone (GH). It is a research grade protein that has been designed to mimic the structure and function of the natural GH, making it a potential treatment option for conditions related to GH deficiency. In this article, we will explore the structure, activity, and potential applications of Redalsomatropin Biosimilar in detail.

Structure of Redalsomatropin Biosimilar

Redalsomatropin Biosimilar is a fusion protein that is composed of two distinct parts – the anti-GH-N antibody and the human growth hormone. The anti-GH-N antibody is a monoclonal antibody that specifically binds to the GH receptor, while the human growth hormone is the active component responsible for the growth-promoting effects. The two components are linked together using recombinant DNA technology, resulting in a single molecule with a unique structure.

The structure of Redalsomatropin Biosimilar is similar to that of the natural GH, with a three-dimensional conformation that is essential for its activity. It contains a single polypeptide chain that is folded into a specific shape, held together by disulfide bonds. This structure is crucial for the protein’s stability and function, as any alteration in its conformation can affect its activity.

Activity of Redalsomatropin Biosimilar

The primary activity of Redalsomatropin Biosimilar is to stimulate growth and development in the body. It does so by binding to the GH receptor on the surface of cells, activating a signaling cascade that leads to the production of insulin-like growth factor 1 (IGF-1). IGF-1, in turn, promotes cell growth and division, leading to an increase in body size and muscle mass.

Redalsomatropin Biosimilar has been shown to have a similar potency and efficacy as the natural GH, making it a potential alternative for the treatment of GH deficiency. It also has a longer half-life compared to the natural GH, allowing for less frequent dosing and potentially improving patient compliance.

Therapeutic Target of Redalsomatropin Biosimilar

The therapeutic target of Redalsomatropin Biosimilar is patients with GH deficiency. GH deficiency can occur due to various reasons, including genetic mutations, pituitary gland disorders, or as a side effect of certain medical treatments. It can lead to growth failure, delayed puberty, and other complications. Redalsomatropin Biosimilar aims to replace the deficient GH and stimulate growth and development in these patients.

In addition to GH deficiency, Redalsomatropin Biosimilar has also shown potential in the treatment of other conditions, such as Turner syndrome and idiopathic short stature. These conditions are characterized by a lack of growth hormone and can benefit from the administration of Redalsomatropin Biosimilar.

Applications of Redalsomatropin Biosimilar

Redalsomatropin Biosimilar has several potential applications in the field of medicine. Its primary use is as a treatment for GH deficiency, as discussed above. However, it also has potential in the treatment of other conditions, such as short stature, osteoporosis, and muscle wasting disorders.

Furthermore, Redalsomatropin Biosimilar can also be used in research studies to investigate the role of GH in various physiological processes. Its availability as a research grade protein allows for its use in laboratory experiments and clinical trials to further understand its mechanism of action and potential therapeutic benefits.

Conclusion

In summary, Redalsomatropin Biosimilar is a research grade therapeutic protein that has been developed as a biosimilar to the human growth hormone. It has a unique structure and activity that mimics the natural GH, making it a potential treatment option for conditions related to GH deficiency. Its primary target is patients with GH deficiency

SDS-PAGE for Redalsomatropin Alfa Biosimilar - Research Grade

SDS-PAGE for Redalsomatropin Alfa Biosimilar - Research Grade

Redalsomatropin Alfa Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Redalsomatropin Biosimilar – Anti-GH-N fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products