Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

EGFP Protein – Enhanced green fluorescent protein(egfp)

Host species:
Escherichia coli (E.coli)
Origin species:
Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Uniprot ID:
C5MKY7
Molecular weight:
32kDa

Original price was: $293.00.Current price is: $250.00.

50ug 15% OFF + 250 loyalty points
Met1–Lys239 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

EGFP Protein - Enhanced green fluorescent protein(egfp)

Product name PX-P4577-1MG
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only.
Molecular Constructor
Met1–Lys239 His
Product name EGFP Protein - Enhanced green fluorescent protein(egfp)
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only
Molecular Constructor
Met1–Lys239 His
Product name EGFP Protein - Enhanced green fluorescent protein(egfp)
Uniprot ID C5MKY7
Uniprot link https://www.uniprot.org/uniprot/C5MKY7
Origin species Human cytomegalovirus (HHV-5) (Human herpesvirus 5)
Expression system Prokaryotic expression
Raw Antigen Sequence MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Molecular weight 32kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239
Protein Accession C5MKY7
NCBI Reference AAK15492
Reference PX-P4577
Note For research use only
Molecular Constructor
Met1–Lys239 His

General information on EGFPprotein

Enhanced green fluorescent protein or EGFP or simply GFP is a protein that exhibit bright green fluorescence when exposed to light in the blue to ultraviolet range. The major advantage of this protein is that it can form internal chromophore whithout requiring any accessory enzymes/substrates, cofactors, gene products other than molecular oxygen. This protein is often used as reporter gene. EGFP can be expressed throughout a given organism, in organs of interest or selected cells. GFP is frequently introduced through transgenic techniques . Regardless, EGFP protein doesn’t affect the genome of the species or that of the offspring. GFP protein has been expressed in a wide range of species including bacteria, fungi, yeast, mammals and even human cells.

The GFP protein is often used as a reporter gene for different essays regarding environmental toxicity levels. Indeed, EGFP protein has been used to demonstrate toxicity levels of different chemicals such as phenol, triclosan, parabens ethanol and p-formaldehyde. The fluroresence is a way of showing how different pollutants can affect the host cells, Another variable that can be easily measured using EGFP protein is the density of cells. A major advantage of EGFP protein is that, depending on how it was introduced in the host cells, in can be heritable. This allows continued study of cells and the tissues where the protein is expressed. Although EGFP protein itself doesn’t interfere with biological processes, it can interact when fused to proteins of interest. Hence, in order to maintain the protein of interest unmodified, careful design of linkers is needed.

In terms of structure, EGFP protein has a soda-shape like structure. It contains a beta barrel that consists of eleven β-strands and a, alpha helix that runs through the center. The beta barrel contains the chromophore which is located in the middle. The alpha helix is covalently bonded to chromophore 4-(p-hydroxybenzylidene)imidazolidin-5-one (HBI). Five shorter alpha helices are located on the ends of the structure.

EGFP Protein - Enhanced green fluorescent protein(egfp)

There are no reviews yet.

Be the first to review “EGFP Protein – Enhanced green fluorescent protein(egfp)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products