Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Slit homolog 2 protein(SLIT2)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O94813
Molecular weight:
26.50kDa

Original price was: $267.00.Current price is: $217.00.

50ug 19% OFF + 217 loyalty points
Leu271–Cys478
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Slit homolog 2 protein(SLIT2)

Product name Slit homolog 2 protein(SLIT2)
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478
Product name Slit homolog 2 protein(SLIT2)
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478
Product name PX-P4478-1MG
Uniprot ID O94813
Uniprot link http://www.uniprot.org/uniprot/O94813
Expression system Prokaryotic expression
Raw Antigen Sequence LHCPAACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKFRC
Molecular weight 26.50kDa
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5, 4M urea 
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu271-Cys478
Aliases /Synonyms SLIL3,Slit-2
Reference PX-P4478
Note For research use only
Molecular Constructor
Leu271–Cys478

General Information about Slit homolog 2 protein

Slit2 is a member of the Slit family. It can send signals through the Roundabout (Robo) receptor and act as a repellent for axon guidance and neuronal migration. It can also act as a chemotactic factor for vascular endothelial cells and a chemotaxis inhibitor for white blood cells. Slit2 is mainly expressed in the lungs, kidneys and adult spinal cord of fetuses, but less in the adrenal glands, thyroid and trachea of ​​adults. Slit2 was originally synthesized as a precursor of 1499 amino acids, and then cleaved into N-terminal and C-terminal fragments, named Slit2-N and Slit2-C, respectively. As measured by the ability to reject olfactory bulb axons and induce branching in dorsal root ganglion axons, activities related to neurodevelopment are only contained in the N-terminal segment.

Slit homolog 2 protein(SLIT2)

There are no reviews yet.

Be the first to review “Slit homolog 2 protein(SLIT2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products