Brand: ProteoGenix

Cell division protein FtsA(ftsA)

PX-P4514-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Uniprot ID:: WP_000588463.1
Molecular weight:: 46.27kDa

$250.00

50ug + 250 loyalty points

full length

size size

50ug $250.00
100ug $469.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Cell division protein FtsA(ftsA)

Product name	Cell division protein FtsA(ftsA)
Uniprot ID	WP_000588463.1
Uniprot link	http://www.uniprot.org/uniprot/WP_000588463.1
Expression system	Prokaryotic expression
Sequence	MGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH
Molecular weight	46.27kDa
Purity estimated	90% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	full length
Reference	PX-P4514
Note	For research use only
Molecular Constructor	full length

Product name	Cell division protein FtsA(ftsA)
Uniprot ID	WP_000588463.1
Uniprot link	http://www.uniprot.org/uniprot/WP_000588463.1
Expression system	Prokaryotic expression
Sequence	MGIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRGMDKGGVNDLESVVKCVQRAIDQAELMADCQISSV YLALSGKHISCQNEIGMVPISEEEVTQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVH LITCHNDMAKNIVKAVERCGLKVDQLIFAGLAASYSVLTEDERELGVCVVDIGGGTMDIAVYTGGALRHTKVIPYAGNVV TSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVGGRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEQL RQQGVKHHLAAGIVLTGGAAQIEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK RVTASVGSWIKRLNSWLRKEFGSHHHHHH
Molecular weight	46.27kDa
Purity estimated	90% by SDS-PAGE
Buffer	PBS, pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	full length
Reference	PX-P4514
Note	For research use only
Molecular Constructor	full length

General Information about Cell division protein FtsA

FtsA stands for “filamentous temperature sensitive A”. FtsA is a bacterial protein that is related to actin through overall structural similarity and its ATP binding pocket. These proteins, along with other bacterial actin homologs (such as MreB, ParM, and MamK), suggest that eukaryotic actins share a common lineage. Like other bacterial actins, FtsA binds to ATP and can form actin-like filaments. The FtsA-FtsA interface has been determined through structural analysis and genetic analysis. Although FtsA is present in many different gram-positive and gram-negative bacterial species, it is not present in actinomycetes and cyanobacteria. The structure of FtsA is also similar to type IV fimbriae ATPase PilM

There are no reviews yet.

Be the first to review “Cell division protein FtsA(ftsA)”

Cell division protein FtsA(ftsA)

Cell division protein FtsA(ftsA)

General Information about Cell division protein FtsA

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Cell division protein FtsA(ftsA)

Specifications Cell division protein FtsA(ftsA)

Description

General Information about Cell division protein FtsA

Documents

Reviews

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Cell division protein FtsA(ftsA)