Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human V32 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
31,33 kDa

Original price was: $275.00.Current price is: $250.00.

50ug 9% OFF + 250 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human V32 Recombinant Protein

Product name Human V32 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPNSNAIQTLPGSCG QVVGSPSAQDEASPLSEWRASYNSAGSNITDARAAAS
Molecular weight 31,33 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer TrisHC 50mMl, 10mM reduced glutathion pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference EAW64442.1*
Aliases /Synonyms V32, galactosidase, beta 1, isoform CRA_a
Reference PX-P1167
Note For research use only
Molecular Constructor
Partial Yes
Product name Human V32 Recombinant Protein
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPNSNAIQTLPGSCG QVVGSPSAQDEASPLSEWRASYNSAGSNITDARAAAS
Molecular weight 31,33 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer TrisHC 50mMl, 10mM reduced glutathion pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference EAW64442.1*
Aliases /Synonyms V32, galactosidase, beta 1, isoform CRA_a
Reference PX-P1167
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1167-1MG
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPNSNAIQTLPGSCG QVVGSPSAQDEASPLSEWRASYNSAGSNITDARAAAS
Molecular weight 31,33 kDa
Protein delivered with Tag? Yes
Purity estimated >95%
Buffer TrisHC 50mMl, 10mM reduced glutathion pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference EAW64442.1*
Aliases /Synonyms V32, galactosidase, beta 1, isoform CRA_a
Reference PX-P1167
Note For research use only
Molecular Constructor
Partial Yes

Human V32 Recombinant Protein

There are no reviews yet.

Be the first to review “Human V32 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products