Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human CD63 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08962
Molecular weight:
10.96 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD63 Recombinant Protein

Human CD63 Recombinant Protein

Product name Human CD63 Recombinant Protein
Uniprot ID P08962
Uniprot link http://www.uniprot.org/uniprot/P08962
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
Molecular weight 10.96 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P08962
Aliases /Synonyms CD63, LAMP-3, ME491, MLA1, OMA81H, Melanoma 1 antigen, Granulophysin, Lysosomal-associated membrane protein 3, Ocular melanoma-associated antigen
Reference PX-P3052
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD63 Recombinant Protein
Uniprot ID P08962
Uniprot link http://www.uniprot.org/uniprot/P08962
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG
Molecular weight 10.96 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference P08962
Aliases /Synonyms CD63, LAMP-3, ME491, MLA1, OMA81H, Melanoma 1 antigen, Granulophysin, Lysosomal-associated membrane protein 3, Ocular melanoma-associated antigen
Reference PX-P3052
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human CD63 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products