Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Galectin-9(LGALS9)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Galectin-9(LGALS9) |
|---|---|
| Uniprot ID | O00182-2 |
| Uniprot link | https://www.uniprot.org/uniprot/O00182 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
| Molecular weight | 61.76kDa |
| Protein delivered with Tag? | N-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Ala2-Thr323 |
| Protein Accession | O00182 |
| Spec:Entrez GeneID | 3965 |
| Spec:NCBI Gene Aliases | HUAT; LGALS9A |
| Spec:SwissProtID | Q3B8N1 |
| NCBI Reference | O00182 |
| Aliases /Synonyms | LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21 |
| Reference | PX-P4585 |
| Note | For research use only |
Related products
Tag Antibody
Anti human IgG Fc tag mouse monoclonal antibody
PTX17868 215$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.