Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Glutamate receptor ionotropic, NMDA 2A(GRIN2A)

Reference:
Size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameGlutamate receptor ionotropic, NMDA 2A(GRIN2A)
Uniprot IDQ12879
Uniprot linkhttps://www.uniprot.org/uniprot/Q12879
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequencePSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQAAGLPLDVNVVALLMNRTDPKSLITHVCDLMSGAR IHGLVFGDDTDQEAVAQMLDFISSHTFVPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYD WHVFSLVTTIFPGYREFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVL ILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGIGILTTAASSMLEKF SYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENHT LSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKK CCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSV PFVETGISVMVSRSNGTVSPSAFLEPFSA
Molecular weight59.53 kDa
Protein delivered with Tag?N terminus His tag
Purity estimated>80% by SDS-PAGE
BufferPBS pH 7.5, 0.02% SKL
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePro23-Ala555
Protein AccessionQ12879
Spec:Entrez GeneID2903
Spec:NCBI Gene AliasesLKS; EPND; FESD; NR2A; GluN2A; NMDAR2A
Spec:SwissProtIDQ17RZ6
NCBI ReferenceQ12879
Aliases /SynonymsGluN2A,Glutamate [NMDA] receptor subunit epsilon-1,N-methyl D-aspartate receptor subtype 2A,NMDAR2A,NR2A,hNR2A,NMDAR2A
ReferencePX-P4792
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Glutamate receptor ionotropic, NMDA 2A(GRIN2A)”

Your email address will not be published. Required fields are marked *

Related products

Anti His tag mouse monoclonal antibody
Tag Antibody

Anti His tag mouse monoclonal antibody

PTX17851 215$

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products