Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Histamine H1 receptor(HRH1) |
---|---|
Uniprot ID | P35367 |
Uniprot link | http://www.uniprot.org/uniprot/P35367 |
Expression system | Prokaryotic expression |
Sequence | MKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKMASPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQGSHHHHHH |
Purity estimated | >90% by SDS-PAGE |
Buffer | 0.02% Sarcosyl+PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Lys212-Gln416 |
Aliases /Synonyms | HRH1,H1R,HH1R |
Reference | PX-P4596 |
Note | For research use only |
In the surrounding tissues, the H1 subclass of histamine receptors mediate the contraction of smooth muscles, the increase in capillary permeability due to the contraction of peripheral venules, the release of catecholamines from the adrenal medulla, and mediate the central nervous system Nerve transmission.
Send us a message from the form below
Reviews
There are no reviews yet.