Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Histamine H1 receptor(HRH1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P35367

Original price was: $249.00.Current price is: $217.00.

50ug 13% OFF + 217 loyalty points
Lys212–Gln416
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Histamine H1 receptor(HRH1)

Product name Histamine H1 receptor(HRH1)
Uniprot ID P35367
Uniprot link http://www.uniprot.org/uniprot/P35367
Expression system Prokaryotic expression
Raw Antigen Sequence KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl+PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys212-Gln416
Aliases /Synonyms HRH1,H1R,HH1R
Reference PX-P4596
Note For research use only
Molecular Constructor
Lys212–Gln416
Product name Histamine H1 receptor(HRH1)
Uniprot ID P35367
Uniprot link http://www.uniprot.org/uniprot/P35367
Expression system Prokaryotic expression
Raw Antigen Sequence KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl+PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys212-Gln416
Aliases /Synonyms HRH1,H1R,HH1R
Reference PX-P4596
Note For research use only
Molecular Constructor
Lys212–Gln416
Product name PX-P4596-1MG
Uniprot ID P35367
Uniprot link http://www.uniprot.org/uniprot/P35367
Expression system Prokaryotic expression
Raw Antigen Sequence KIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQL
Purity estimated >90% by SDS-PAGE
Buffer 0.02% Sarcosyl+PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys212-Gln416
Aliases /Synonyms HRH1,H1R,HH1R
Reference PX-P4596
Note For research use only
Molecular Constructor
Lys212–Gln416

General Information about Histamine H1 receptor (HRH1)

In the surrounding tissues, the H1 subclass of histamine receptors mediate the contraction of smooth muscles, the increase in capillary permeability due to the contraction of peripheral venules, the release of catecholamines from the adrenal medulla, and mediate the central nervous system Nerve transmission.

Histamine H1 receptor(HRH1)

There are no reviews yet.

Be the first to review “Histamine H1 receptor(HRH1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products