Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

ProGRP

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P07492

$250.00

50ug + 250 loyalty points
Ser54–Asp121 No
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
ProGRP

ProGRP

Product name ProGRP
Uniprot ID P07492
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LEVLFQGPSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD
Protein delivered with Tag? No tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser54-Asp121
Reference PX-P4699
Note For research use only
Molecular Constructor
Ser54–Asp121 No
Product name ProGRP
Uniprot ID P07492
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence LEVLFQGPSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKD
Protein delivered with Tag? No tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser54-Asp121
Reference PX-P4699
Note For research use only
Molecular Constructor
Ser54–Asp121 No

There are no reviews yet.

Be the first to review “ProGRP”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products