Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Glucagon-like peptide 1 receptor(GLP1R) protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P43220
Molecular weight:
14.31 kDa

Original price was: $115.00.Current price is: $99.00.

50ug 14% OFF + 99 loyalty points
His Arg24–Tyr145
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Glucagon-like peptide 1 receptor(GLP1R) protein

Product name Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145
Product name Glucagon-like peptide 1 receptor(GLP1R) protein
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145
Product name PX-P4732-1MG
Uniprot ID P43220
Uniprot link https://www.uniprot.org/uniprot/P43220
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY
Molecular weight 14.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >95%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL, 5% trehalose
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg24-Tyr145
Protein Accession P43220
Spec:Entrez GeneID 2740
Spec:NCBI Gene Aliases GLP-1; GLP-1R; GLP-1-R
Spec:SwissProtID Q2M229
NCBI Reference P43220
Aliases /Synonyms GLP-1 receptor,GLP-1-R,GLP-1R
Reference PX-P4732
Note For research use only
Molecular Constructor
His Arg24–Tyr145

Glucagon-like peptide 1 receptor(GLP1R) protein

There are no reviews yet.

Be the first to review “Glucagon-like peptide 1 receptor(GLP1R) protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products