Cart (0 Items)
Your cart is currently empty.
View Products
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Histone H3.1(HIST1H3A) |
|---|---|
| Uniprot ID | P68431/Q6LED0/Q6LBF0/P68433 |
| Uniprot link | https://www.uniprot.org/uniprot/P68431 |
| Origin species | General |
| Expression system | Prokaryotic expression |
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Molecular weight | 16.47kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH 7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1~Ala136 |
| Protein Accession | P68431 |
| Spec:Entrez GeneID | 8350 |
| Spec:NCBI Gene Aliases | H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A |
| NCBI Reference | P68431 |
| Aliases /Synonyms | H3FJ |
| Reference | PX-P4575 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.