Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Histone H3.1(HIST1H3A)

Host species:
Escherichia coli (E.coli)
Origin species:
General
Molecular weight:
16.47kDa

$169.00

100ug + 169 loyalty points
Met1~Ala136 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Histone H3.1(HIST1H3A)

Product name Histone H3.1(HIST1H3A)
Uniprot ID P68431/Q6LED0/Q6LBF0/P68433
Uniprot link https://www.uniprot.org/uniprot/P68431
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 16.47kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Ala136
Protein Accession P68431
Spec:Entrez GeneID 8350
Spec:NCBI Gene Aliases H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A
NCBI Reference P68431
Aliases /Synonyms H3FJ
Reference PX-P4575
Note For research use only
Molecular Constructor
Met1~Ala136 His
Product name Histone H3.1(HIST1H3A)
Uniprot ID P68431/Q6LED0/Q6LBF0/P68433
Uniprot link https://www.uniprot.org/uniprot/P68431
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 16.47kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Ala136
Protein Accession P68431
Spec:Entrez GeneID 8350
Spec:NCBI Gene Aliases H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A
NCBI Reference P68431
Aliases /Synonyms H3FJ
Reference PX-P4575
Note For research use only
Molecular Constructor
Met1~Ala136 His

There are no reviews yet.

Be the first to review “Histone H3.1(HIST1H3A)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products