Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

G1-S specific cyclin-D1(CCND1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P24385
Molecular weight:
20.69 kDa

Original price was: $318.00.Current price is: $250.00.

50ug 21% OFF + 250 loyalty points
His Leu65–Arg245
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

G1-S specific cyclin-D1(CCND1)

Product name G1-S specific cyclin-D1(CCND1)
Uniprot ID P24385
Uniprot link https://www.uniprot.org/uniprot/P24385
Expression system Prokaryotic expression
Raw Antigen Sequence LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR
Molecular weight 20.69 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu65-Arg245
Protein Accession P24385
Spec:Entrez GeneID 595
Spec:NCBI Gene Aliases BCL1; PRAD1; U21B31; D11S287E
Spec:SwissProtID Q6LEF0
NCBI Reference P24385
Aliases /Synonyms B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1
Reference PX-P4712
Note For research use only
Molecular Constructor
His Leu65–Arg245
Product name G1-S specific cyclin-D1(CCND1)
Uniprot ID P24385
Uniprot link https://www.uniprot.org/uniprot/P24385
Expression system Prokaryotic expression
Raw Antigen Sequence LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR
Molecular weight 20.69 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu65-Arg245
Protein Accession P24385
Spec:Entrez GeneID 595
Spec:NCBI Gene Aliases BCL1; PRAD1; U21B31; D11S287E
Spec:SwissProtID Q6LEF0
NCBI Reference P24385
Aliases /Synonyms B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1
Reference PX-P4712
Note For research use only
Molecular Constructor
His Leu65–Arg245
Product name PX-P4712-1MG
Uniprot ID P24385
Uniprot link https://www.uniprot.org/uniprot/P24385
Expression system Prokaryotic expression
Raw Antigen Sequence LEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLR
Molecular weight 20.69 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu65-Arg245
Protein Accession P24385
Spec:Entrez GeneID 595
Spec:NCBI Gene Aliases BCL1; PRAD1; U21B31; D11S287E
Spec:SwissProtID Q6LEF0
NCBI Reference P24385
Aliases /Synonyms B-cell lymphoma 1 protein,BCL-1,BCL-1 oncogene,PRAD1 oncogene,BCL1, PRAD1
Reference PX-P4712
Note For research use only
Molecular Constructor
His Leu65–Arg245

G1-S specific cyclin-D1(CCND1)

There are no reviews yet.

Be the first to review “G1-S specific cyclin-D1(CCND1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products