Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
hSAss-TwinStrep-MYBPHL_iso (MYBPHL)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | hSAss-TwinStrep-MYBPHL_iso (MYBPHL) |
|---|---|
| Uniprot ID | A2RUH7 |
| Uniprot link | https://www.uniprot.org/uniprot/A2RUH7 |
| Expression system | Eukaryotic expression |
| Sequence | MKWVTFISLLFLFSSAYSASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN |
| Molecular weight | 41.34KDa |
| Purity estimated | 40% by SDS-PAGE |
| Buffer | 50mM Tris-Cl pH 7.5, 150mM NaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Asn354 |
| Aliases /Synonyms | MYBPHL/Myosin-binding protein H-like |
| Reference | PX-P4387 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.