Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

hSAss-TwinStrep-MYBPHL_iso (MYBPHL)

Host species:
Mammalian cells
Uniprot ID:
A2RUH7
Molecular weight:
41.34KDa

$250.00

50ug + 250 loyalty points
Met1–Asn354
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

hSAss-TwinStrep-MYBPHL_iso (MYBPHL)

Product name hSAss-TwinStrep-MYBPHL_iso (MYBPHL)
Uniprot ID A2RUH7
Uniprot link https://www.uniprot.org/uniprot/A2RUH7
Expression system Eukaryotic expression
Raw Antigen Sequence MKWVTFISLLFLFSSAYSASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Molecular weight 41.34KDa
Purity estimated 40% by SDS-PAGE
Buffer 50mM Tris-Cl pH 7.5, 150mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn354
Aliases /Synonyms MYBPHL/Myosin-binding protein H-like
Reference PX-P4387
Note For research use only
Molecular Constructor
Met1–Asn354
Product name hSAss-TwinStrep-MYBPHL_iso (MYBPHL)
Uniprot ID A2RUH7
Uniprot link https://www.uniprot.org/uniprot/A2RUH7
Expression system Eukaryotic expression
Raw Antigen Sequence MKWVTFISLLFLFSSAYSASWSHPQFEKGGGSGGGSGGSAWSHPQFEKMEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADSERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN
Molecular weight 41.34KDa
Purity estimated 40% by SDS-PAGE
Buffer 50mM Tris-Cl pH 7.5, 150mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Asn354
Aliases /Synonyms MYBPHL/Myosin-binding protein H-like
Reference PX-P4387
Note For research use only
Molecular Constructor
Met1–Asn354

There are no reviews yet.

Be the first to review “hSAss-TwinStrep-MYBPHL_iso (MYBPHL)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products