Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD160 antigen (1-179)

Host species:
Mammalian cells
Uniprot ID:
O95971
Molecular weight:
22.52kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Mer1–Gln179 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD160 antigen (1-179)

Product name CD160 antigen (1-179)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His
Product name CD160 antigen (1-179)
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His
Product name PX-P4469-1MG
Uniprot ID O95971
Uniprot link https://www.uniprot.org/uniprot/O95971
Expression system Eukaryotic expression
Raw Antigen Sequence MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQGMSKRAVSTPSNEGAGGGSGGHHHHHHHH
Molecular weight 22.52kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Mer1-Gln179
Protein Accession O95971
Spec:Entrez GeneID 11126
Spec:NCBI Gene Aliases NK1; BY55; NK28
Spec:SwissProtID Q5T2V6
NCBI Reference O95971
Aliases /Synonyms Natural killer cell receptor BY55 / CD_antigen: CD160
Reference PX-P4469
Note For research use only
Molecular Constructor
Mer1–Gln179 His

CD160 antigen (1-179)

There are no reviews yet.

Be the first to review “CD160 antigen (1-179)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products