Cart (0 Items)
Your cart is currently empty.
View Products
| size | 1000U |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human 3C Protease Recombinant Enzyme (GST tag- His Tag) |
|---|---|
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAHNHRHKH |
| Molecular weight | 47,38 kDa |
| Protein delivered with Tag? | Yes |
| Buffer | Tris 50mMHCl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Property sequence |
| Protein Accession | NP_740524.1 |
| NCBI Reference | NP_740524.1 |
| Aliases /Synonyms | #N/A |
| Reference | PX-P1107 |
| Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.