Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Molecular weight:
47,38 kDa

$392.00

1000U + 392 loyalty points
Property sequence Yes
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human 3C Protease Recombinant Enzyme (GST tag- His Tag)

Product name Human 3C Protease Recombinant Enzyme (GST tag- His Tag)
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSGPNTEFALSLLRKN IMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDL EGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLK KQYFVEKQAAAHNHRHKH
Molecular weight 47,38 kDa
Protein delivered with Tag? Yes
Buffer Tris 50mMHCl pH8, NaCl 150mM, EDTA 10mM, DTT 1mM and 20% Glycerol
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Property sequence
Protein Accession NP_740524.1
NCBI Reference NP_740524.1
Aliases /Synonyms #N/A
Reference PX-P1107
Note For research use only
Molecular Constructor
Property sequence Yes

There are no reviews yet.

Be the first to review “Human 3C Protease Recombinant Enzyme (GST tag- His Tag)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products