Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human CD36 (AA 104-294) Recombinant Protein |
|---|---|
| Uniprot ID | P16671 |
| Uniprot link | http://www.uniprot.org/uniprot/P16671 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF |
| Molecular weight | 22,73 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS, imidazole 300mM, Urea 8M, pH7.4 |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAA16068.1 |
| Spec:Entrez GeneID | 948 |
| Spec:NCBI Gene Aliases | CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4 |
| Spec:SwissProtID | P16671 |
| NCBI Reference | AAA16068.1 |
| Aliases /Synonyms | CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4 |
| Reference | PX-P1061 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.