Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Human CD36 (AA 104-294) Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman CD36 (AA 104-294) Recombinant Protein
Uniprot IDP16671
Uniprot linkhttp://www.uniprot.org/uniprot/P16671
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF
Molecular weight22,73 kDa
Protein delivered with Tag?Yes
Purity estimated80%
BufferPBS, imidazole 300mM, Urea 8M, pH7.4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAA16068.1
Spec:Entrez GeneID948
Spec:NCBI Gene AliasesCHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4
Spec:SwissProtIDP16671
NCBI ReferenceAAA16068.1
Aliases /SynonymsCD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4
ReferencePX-P1061
NoteFor research use only

Publication

  • 1: Å erý O, Janoutová J, Ewerlingová L, Hálová A, Lochman J, Janout V, Khan NA,_x000D_ Balcar VJ. CD36 gene polymorphism is associated with Alzheimer's disease._x000D_ Biochimie. 2017 Apr;135:46-53. doi: 10.1016/j.biochi.2017.01.009. Epub 2017 Jan_x000D_ 20. PubMed PMID: 28111291.
  • _x000D_ _x000D_ _x000D_
  • 2: Sini S, Deepa D, Harikrishnan S, Jayakumari N. High-density lipoprotein from_x000D_ subjects with coronary artery disease promotes macrophage foam cell formation:_x000D_ role of scavenger receptor CD36 and ERK/MAPK signaling. Mol Cell Biochem. 2017_x000D_ Mar;427(1-2):23-34. doi: 10.1007/s11010-016-2895-7. Epub 2016 Dec 19. PubMed_x000D_ PMID: 27995417.
  • _x000D_ _x000D_ _x000D_
  • 3: Pascual G, Avgustinova A, Mejetta S, Martín M, Castellanos A, Attolini CS,_x000D_ Berenguer A, Prats N, Toll A, Hueto JA, Bescós C, Di Croce L, Benitah SA._x000D_ Targeting metastasis-initiating cells through the fatty acid receptor CD36._x000D_ Nature. 2017 Jan 5;541(7635):41-45. doi: 10.1038/nature20791. Epub 2016 Dec 7._x000D_ PubMed PMID: 27974793.
  • _x000D_ _x000D_ _x000D_
  • 4: Kalai M, Dridi M, Chaouch L, Moumni I, Ouragini H, Darragi I, Boudrigua I,_x000D_ Chaouachi D, Mellouli F, Bejaoui M, Abbes S. The role of rs1984112_G at CD36 gene_x000D_ in increasing reticulocyte level among sickle cell disease patients. Hematology. _x000D_ 2017 Apr;22(3):178-182. doi: 10.1080/10245332.2016.1253253. Epub 2016 Nov 20._x000D_ PubMed PMID: 27869039.
  • _x000D_ _x000D_ _x000D_
  • 5: Jayewardene AF, Mavros Y, Gwinn T, Hancock DP, Rooney KB. Associations between_x000D_ CD36 gene polymorphisms and metabolic response to a short-term endurance-training_x000D_ program in a young-adult population. Appl Physiol Nutr Metab. 2016_x000D_ Feb;41(2):157-67. doi: 10.1139/apnm-2015-0430. Epub 2015 Oct 22. PubMed PMID:_x000D_ 26830498.
  • _x000D_ _x000D_ _x000D_
  • 6: Daoudi H, Plesník J, Sayed A, Å erý O, Rouabah A, Rouabah L, Khan NA. Oral Fat _x000D_ Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers._x000D_ Nutrients. 2015 Nov 4;7(11):9096-104. doi: 10.3390/nu7115455. PubMed PMID:_x000D_ 26556365; PubMed Central PMCID: PMC4663583.
  • _x000D_ _x000D_ _x000D_
  • 7: Lo SC, Lin KH, Hsieh HH, Lin DT, Hu CY. Genetic variations of CD36 and low_x000D_ platelet CD36 expression - a risk factor for lipemic plasma donation in Taiwanese_x000D_ apheresis donors. Vox Sang. 2016 Apr;110(3):236-43. doi: 10.1111/vox.12356. Epub _x000D_ 2015 Nov 3. PubMed PMID: 26528880.
  • _x000D_ _x000D_ _x000D_
  • 8: Hou Y, Wu M, Wei J, Ren Y, Du C, Wu H, Li Y, Shi Y. CD36 is involved in high_x000D_ glucose-induced epithelial to mesenchymal transition in renal tubular epithelial _x000D_ cells. Biochem Biophys Res Commun. 2015 Dec 4-11;468(1-2):281-6. doi:_x000D_ 10.1016/j.bbrc.2015.10.112. Epub 2015 Oct 24. PubMed PMID: 26505798.
  • _x000D_ _x000D_ _x000D_
  • 9: Nath A, Li I, Roberts LR, Chan C. Elevated free fatty acid uptake via CD36_x000D_ promotes epithelial-mesenchymal transition in hepatocellular carcinoma. Sci Rep. _x000D_ 2015 Oct 1;5:14752. doi: 10.1038/srep14752. PubMed PMID: 26424075; PubMed Central_x000D_ PMCID: PMC4589791.
  • _x000D_ _x000D_ _x000D_
  • 10: Sundaresan S, Abumrad NA. Dietary Lipids Inform the Gut and Brain about Meal _x000D_ Arrival via CD36-Mediated Signal Transduction. J Nutr. 2015 Oct;145(10):2195-200._x000D_ doi: 10.3945/jn.115.215483. Epub 2015 Aug 12. Review. PubMed PMID: 26269236;_x000D_ PubMed Central PMCID: PMC4580959.
  • _x000D_ _x000D_ _x000D_
  • 11: Schörghofer D, Kinslechner K, Preitschopf A, Schütz B, Röhrl C,_x000D_ Hengstschläger M, Stangl H, Mikula M. The HDL receptor SR-BI is associated with_x000D_ human prostate cancer progression and plays a possible role in establishing_x000D_ androgen independence. Reprod Biol Endocrinol. 2015 Aug 7;13:88. doi:_x000D_ 10.1186/s12958-015-0087-z. PubMed PMID: 26251134; PubMed Central PMCID:_x000D_ PMC4528807.
  • _x000D_ _x000D_ _x000D_
  • 12: Allum F, Shao X, Guénard F, Simon MM, Busche S, Caron M, Lambourne J, Lessard_x000D_ J, Tandre K, Hedman Ã…K, Kwan T, Ge B; Multiple Tissue Human Expression Resource_x000D_ Consortium., Rönnblom L, McCarthy MI, Deloukas P, Richmond T, Burgess D, Spector _x000D_ TD, Tchernof A, Marceau S, Lathrop M, Vohl MC, Pastinen T, Grundberg E._x000D_ Characterization of functional methylomes by next-generation capture sequencing_x000D_ identifies novel disease-associated variants. Nat Commun. 2015 May 29;6:7211._x000D_ doi: 10.1038/ncomms8211. Erratum in: Nat Commun. 2015;6:8016. PubMed PMID:_x000D_ 26021296; PubMed Central PMCID: PMC4544751.
  • _x000D_ _x000D_ _x000D_
  • 13: Krzystolik A, Dziedziejko V, Safranow K, Kurzawski G, Rać M, Sagasz-Tysiewicz_x000D_ D, Poncyljusz W, Jakubowska K, Chlubek D, Rać ME. Is plasma soluble CD36_x000D_ associated with cardiovascular risk factors in early onset coronary artery_x000D_ disease patients? Scand J Clin Lab Invest. 2015 Sep;75(5):398-406. doi:_x000D_ 10.3109/00365513.2015.1031693. Epub 2015 Apr 28. PubMed PMID: 25916834.
  • _x000D_ _x000D_ _x000D_
  • 14: Mrizak I, Å erý O, Plesnik J, Arfa A, Fekih M, Bouslema A, Zaouali M, Tabka Z,_x000D_ Khan NA. The A allele of cluster of differentiation 36 (CD36) SNP 1761667_x000D_ associates with decreased lipid taste perception in obese Tunisian women. Br J_x000D_ Nutr. 2015 Apr 28;113(8):1330-7. doi: 10.1017/S0007114515000343. Epub 2015 Mar_x000D_ 30. PubMed PMID: 25822988.
  • _x000D_ _x000D_ _x000D_
  • 15: Melis M, Sollai G, Muroni P, Crnjar R, Barbarossa IT. Associations between_x000D_ orosensory perception of oleic acid, the common single nucleotide polymorphisms_x000D_ (rs1761667 and rs1527483) in the CD36 gene, and 6-n-propylthiouracil (PROP)_x000D_ tasting. Nutrients. 2015 Mar 20;7(3):2068-84. doi: 10.3390/nu7032068. PubMed_x000D_ PMID: 25803547; PubMed Central PMCID: PMC4377901.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human CD36 (AA 104-294) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below

    Cart (0 Items)

    Your cart is currently empty.

    View Products