Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD36 (AA 104-294) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16671
Molecular weight:
22,73 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD36 (AA 104-294) Recombinant Protein

Product name Human CD36 (AA 104-294) Recombinant Protein
Uniprot ID P16671
Uniprot link http://www.uniprot.org/uniprot/P16671
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF
Molecular weight 22,73 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, imidazole 300mM, Urea 8M, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA16068.1
Spec:Entrez GeneID 948
Spec:NCBI Gene Aliases CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4
Spec:SwissProtID P16671
NCBI Reference AAA16068.1
Aliases /Synonyms CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4
Reference PX-P1061
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD36 (AA 104-294) Recombinant Protein
Uniprot ID P16671
Uniprot link http://www.uniprot.org/uniprot/P16671
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF
Molecular weight 22,73 kDa
Protein delivered with Tag? Yes
Purity estimated 80%
Buffer PBS, imidazole 300mM, Urea 8M, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAA16068.1
Spec:Entrez GeneID 948
Spec:NCBI Gene Aliases CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4
Spec:SwissProtID P16671
NCBI Reference AAA16068.1
Aliases /Synonyms CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4
Reference PX-P1061
Note For research use only
Molecular Constructor
Partial Yes

  • Šerý O, Janoutová J, Ewerlingová L, Hálová A, Lochman J, Janout V, Khan NA, Balcar VJ. CD36 gene polymorphism is associated with Alzheimer's disease. Biochimie. 2017 Apr;135:46-53. doi: 10.1016/j.biochi.2017.01.009. Epub 2017 Jan 20. PubMed PMID: 28111291.
  • Sini S, Deepa D, Harikrishnan S, Jayakumari N. High-density lipoprotein from subjects with coronary artery disease promotes macrophage foam cell formation: role of scavenger receptor CD36 and ERK/MAPK signaling. Mol Cell Biochem. 2017 Mar;427(1-2):23-34. doi: 10.1007/s11010-016-2895-7. Epub 2016 Dec 19. PubMed PMID: 27995417.
  • Pascual G, Avgustinova A, Mejetta S, Martín M, Castellanos A, Attolini CS, Berenguer A, Prats N, Toll A, Hueto JA, Bescós C, Di Croce L, Benitah SA. Targeting metastasis-initiating cells through the fatty acid receptor CD36. Nature. 2017 Jan 5;541(7635):41-45. doi: 10.1038/nature20791. Epub 2016 Dec 7. PubMed PMID: 27974793.
  • Kalai M, Dridi M, Chaouch L, Moumni I, Ouragini H, Darragi I, Boudrigua I, Chaouachi D, Mellouli F, Bejaoui M, Abbes S. The role of rs1984112_G at CD36 gene in increasing reticulocyte level among sickle cell disease patients. Hematology. 2017 Apr;22(3):178-182. doi: 10.1080/10245332.2016.1253253. Epub 2016 Nov 20. PubMed PMID: 27869039.
  • Jayewardene AF, Mavros Y, Gwinn T, Hancock DP, Rooney KB. Associations between CD36 gene polymorphisms and metabolic response to a short-term endurance-training program in a young-adult population. Appl Physiol Nutr Metab. 2016 Feb;41(2):157-67. doi: 10.1139/apnm-2015-0430. Epub 2015 Oct 22. PubMed PMID: 26830498.
  • Daoudi H, Plesník J, Sayed A, Šerý O, Rouabah A, Rouabah L, Khan NA. Oral Fat Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers. Nutrients. 2015 Nov 4;7(11):9096-104. doi: 10.3390/nu7115455. PubMed PMID: 26556365; PubMed Central PMCID: PMC4663583.
  • Lo SC, Lin KH, Hsieh HH, Lin DT, Hu CY. Genetic variations of CD36 and low platelet CD36 expression - a risk factor for lipemic plasma donation in Taiwanese apheresis donors. Vox Sang. 2016 Apr;110(3):236-43. doi: 10.1111/vox.12356. Epub 2015 Nov 3. PubMed PMID: 26528880.
  • Hou Y, Wu M, Wei J, Ren Y, Du C, Wu H, Li Y, Shi Y. CD36 is involved in high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells. Biochem Biophys Res Commun. 2015 Dec 4-11;468(1-2):281-6. doi: 10.1016/j.bbrc.2015.10.112. Epub 2015 Oct 24. PubMed PMID: 26505798.
  • Nath A, Li I, Roberts LR, Chan C. Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma. Sci Rep. 2015 Oct 1;5:14752. doi: 10.1038/srep14752. PubMed PMID: 26424075; PubMed Central PMCID: PMC4589791.
  • Sundaresan S, Abumrad NA. Dietary Lipids Inform the Gut and Brain about Meal Arrival via CD36-Mediated Signal Transduction. J Nutr. 2015 Oct;145(10):2195-200. doi: 10.3945/jn.115.215483. Epub 2015 Aug 12. Review. PubMed PMID: 26269236; PubMed Central PMCID: PMC4580959.
  • Schörghofer D, Kinslechner K, Preitschopf A, Schütz B, Röhrl C, Hengstschläger M, Stangl H, Mikula M. The HDL receptor SR-BI is associated with human prostate cancer progression and plays a possible role in establishing androgen independence. Reprod Biol Endocrinol. 2015 Aug 7;13:88. doi: 10.1186/s12958-015-0087-z. PubMed PMID: 26251134; PubMed Central PMCID: PMC4528807.
  • Allum F, Shao X, Guénard F, Simon MM, Busche S, Caron M, Lambourne J, Lessard J, Tandre K, Hedman ÅK, Kwan T, Ge B; Multiple Tissue Human Expression Resource Consortium., Rönnblom L, McCarthy MI, Deloukas P, Richmond T, Burgess D, Spector TD, Tchernof A, Marceau S, Lathrop M, Vohl MC, Pastinen T, Grundberg E. Characterization of functional methylomes by next-generation capture sequencing identifies novel disease-associated variants. Nat Commun. 2015 May 29;6:7211. doi: 10.1038/ncomms8211. Erratum in: Nat Commun. 2015;6:8016. PubMed PMID: 26021296; PubMed Central PMCID: PMC4544751.
  • Krzystolik A, Dziedziejko V, Safranow K, Kurzawski G, Rać M, Sagasz-Tysiewicz D, Poncyljusz W, Jakubowska K, Chlubek D, Rać ME. Is plasma soluble CD36 associated with cardiovascular risk factors in early onset coronary artery disease patients? Scand J Clin Lab Invest. 2015 Sep;75(5):398-406. doi: 10.3109/00365513.2015.1031693. Epub 2015 Apr 28. PubMed PMID: 25916834.
  • Mrizak I, Šerý O, Plesnik J, Arfa A, Fekih M, Bouslema A, Zaouali M, Tabka Z, Khan NA. The A allele of cluster of differentiation 36 (CD36) SNP 1761667 associates with decreased lipid taste perception in obese Tunisian women. Br J Nutr. 2015 Apr 28;113(8):1330-7. doi: 10.1017/S0007114515000343. Epub 2015 Mar 30. PubMed PMID: 25822988.
  • Melis M, Sollai G, Muroni P, Crnjar R, Barbarossa IT. Associations between orosensory perception of oleic acid, the common single nucleotide polymorphisms (rs1761667 and rs1527483) in the CD36 gene, and 6-n-propylthiouracil (PROP) tasting. Nutrients. 2015 Mar 20;7(3):2068-84. doi: 10.3390/nu7032068. PubMed PMID: 25803547; PubMed Central PMCID: PMC4377901.

There are no reviews yet.

Be the first to review “Human CD36 (AA 104-294) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products