Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD72 (Lys221-Asp359) recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P21854
Molecular weight:
43.4 kDa

$380.00

100ug + 380 loyalty points
Lys221–Asp359 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD72 (Lys221-Asp359) recombinant protein

Human CD72 (Lys221-Asp359) recombinant protein

Product name Human CD72 (Lys221-Asp359) recombinant protein
Uniprot ID P21854
Uniprot link https://www.uniprot.org/uniprot/Q01973
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
Molecular weight 43.4 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Lys221-Asp359
Aliases /Synonyms Lyb-2, Lyb2
Reference PX-P6003
Note For research use only
Molecular Constructor
Lys221–Asp359 His

Human CD72 (Lys221-Asp359) recombinant protein

There are no reviews yet.

Be the first to review “Human CD72 (Lys221-Asp359) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products