Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Engrailed1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human Engrailed1 Recombinant Protein |
|---|---|
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE |
| Molecular weight | 42.14 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 60% |
| Buffer | PO4(pH:7.4) 20 mM with about 0.5M NaCl |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Aliases /Synonyms | Engrailed1 |
| Reference | PX-P3062 |
| Note | For research use only |
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.