Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Engrailed1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Molecular weight:
42.14 kDa

Original price was: $466.00.Current price is: $409.00.

50ug 12% OFF + 409 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Engrailed1 Recombinant Protein

Product name PX-P3062-100
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Molecular weight 42.14 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PO4(pH:7.4) 20 mM with about 0.5M NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Engrailed1
Reference PX-P3062
Note For research use only.
Molecular Constructor
Full-length Yes
Product name PX-P3062-1MG
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Molecular weight 42.14 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PO4(pH:7.4) 20 mM with about 0.5M NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Engrailed1
Reference PX-P3062
Note For research use only.
Molecular Constructor
Full-length Yes
Product name PX-P3062-50
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGENLYFQGMEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAHHPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVAAAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
Molecular weight 42.14 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer PO4(pH:7.4) 20 mM with about 0.5M NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Engrailed1
Reference PX-P3062
Note For research use only.
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Human Engrailed1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products