Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 5ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human FGF10 Recombinant Protein |
---|---|
Uniprot ID | O15520 |
Uniprot link | http://www.uniprot.org/uniprot/O15520 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MAQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSLEHHHHHH |
Molecular weight | 20.59 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS,pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
NCBI Reference | O15520 |
Aliases /Synonyms | Keratinocyte Growth Factor proteins 2,Fibroblast Growth Factor proteins 10, FGF10 |
Reference | PX-P3026 |
Note | For research use only |
Send us a message from the form below
Reviews
There are no reviews yet.