Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FGF10 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O15520
Molecular weight:
20.59 kDa

$143.00

5ug + 143 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FGF10 Recombinant Protein

Product name Human FGF10 Recombinant Protein
Uniprot ID O15520
Uniprot link http://www.uniprot.org/uniprot/O15520
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSLEHHHHHH
Molecular weight 20.59 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference O15520
Aliases /Synonyms Keratinocyte Growth Factor proteins 2,Fibroblast Growth Factor proteins 10, FGF10
Reference PX-P3026
Note For research use only
Molecular Constructor
Partial Yes
Product name Human FGF10 Recombinant Protein
Uniprot ID O15520
Uniprot link http://www.uniprot.org/uniprot/O15520
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Sequence MAQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSLEHHHHHH
Molecular weight 20.59 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference O15520
Aliases /Synonyms Keratinocyte growth factor 2,Fibroblast Growth Factor 10, FGF10
Reference PX-P3026
Note For research use only
Molecular Constructor
Partial Yes
Product name Human FGF10 Recombinant Protein
Uniprot ID O15520
Uniprot link http://www.uniprot.org/uniprot/O15520
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSLEHHHHHH
Molecular weight 20.59 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference O15520
Aliases /Synonyms Keratinocyte Growth Factor proteins 2,Fibroblast Growth Factor proteins 10, FGF10
Reference PX-P3026
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human FGF10 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products