Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Probetacellulin(BTC)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P35070
Molecular weight:
8.99 kDa

$392.00

100ug + 392 loyalty points
His Asp32–Tyr111
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Probetacellulin(BTC)

Product name Probetacellulin(BTC)
Uniprot ID P35070
Uniprot link https://www.uniprot.org/uniprot/P35070
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGAR CERVDLFY
Molecular weight 8.99 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp32-Tyr111
Protein Accession P35070
Spec:Entrez GeneID 685
Spec:SwissProtID Q96F48
NCBI Reference P35070
Reference PX-P4787
Note For research use only
Molecular Constructor
His Asp32–Tyr111
Product name Probetacellulin(BTC)
Uniprot ID P35070
Uniprot link https://www.uniprot.org/uniprot/P35070
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGAR CERVDLFY
Molecular weight 8.99 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp32-Tyr111
Protein Accession P35070
Spec:Entrez GeneID 685
Spec:SwissProtID Q96F48
NCBI Reference P35070
Reference PX-P4787
Note For research use only
Molecular Constructor
His Asp32–Tyr111

There are no reviews yet.

Be the first to review “Probetacellulin(BTC)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products