Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human BDNF

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P23560
Molecular weight:
15.16kDa

$217.00

50ug + 217 loyalty points
His Arg128–Arg247
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human BDNF

Product name Human BDNF
Uniprot ID P23560
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Molecular weight 15.16kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg128-Arg247
Aliases /Synonyms Brain-derived neurotrophic factor,BDNF,Abrineurin,BDNF precursor form,ProBDNF
Reference PX-P4907
Note For research use only
Molecular Constructor
His Arg128–Arg247
Product name Human BDNF
Uniprot ID P23560
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence RHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Molecular weight 15.16kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS,pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg128-Arg247
Aliases /Synonyms Brain-derived neurotrophic factor,BDNF,Abrineurin,BDNF precursor form,ProBDNF
Reference PX-P4907
Note For research use only
Molecular Constructor
His Arg128–Arg247

Human BDNF

There are no reviews yet.

Be the first to review “Human BDNF”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products