Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human Galectin 8 (GAL8) recombinant protein |
---|---|
Uniprot ID | O00214 |
Uniprot link | http://www.uniprot.org/uniprot/O00214 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWDYKDDDDK |
Molecular weight | 60kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 70% |
Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Aliases /Synonyms | LGALS8, PCTA1, Po66-CBP, Prostate Carcinoma Tumor Antigen 1, Lectin,Galactoside-Binding Soluble 8, Po66 carbohydrate-binding protein, Prostate carcinoma tumor antigen 1 |
Reference | PX-P4019 |
Note | For research use only |
Human Galectin 8 (GAL8) is a member of the galectin family of proteins, which are characterized by their ability to bind to carbohydrate structures on the surface of cells. GAL8 is a highly conserved protein found in a variety of species, including humans. It plays a crucial role in various biological processes, making it a potential drug target for a range of diseases.
GAL8 is a small protein consisting of 323 amino acids with a molecular weight of approximately 36 kDa. It contains two distinct domains: a carbohydrate recognition domain (CRD) and a non-lectin domain (NLD). The CRD is responsible for binding to specific carbohydrate structures, while the NLD is involved in protein-protein interactions.
The CRD of GAL8 has a characteristic β-sandwich fold, with two β-sheets forming a concave surface that can accommodate carbohydrate ligands. The NLD, on the other hand, has a more flexible structure and is thought to play a role in regulating the activity of the CRD.
GAL8 is a multifunctional protein with diverse activities in various biological processes. Its main function is to bind to specific carbohydrate structures, such as N-acetyllactosamine, on the surface of cells. This binding can lead to a variety of downstream effects, including cell adhesion, migration, and signaling.
In addition to its role in cell-cell interactions, GAL8 also plays a role in regulating the immune response. It has been shown to modulate the activity of immune cells, such as T cells and macrophages, by binding to specific receptors on their surface.
Furthermore, GAL8 has been implicated in cancer progression. It has been found to be overexpressed in various types of cancer and is thought to promote tumor growth and metastasis by enhancing cell adhesion and migration.
Given its diverse activities, GAL8 has been studied as a potential drug target for various diseases. One of the most promising applications is in the treatment of autoimmune diseases. By modulating the activity of immune cells, GAL8 has the potential to suppress the immune response and reduce inflammation in diseases such as rheumatoid arthritis and multiple sclerosis.
In addition, GAL8 has also been investigated as a potential target for cancer therapy. By targeting its activity, it may be possible to inhibit tumor growth and metastasis. Several studies have shown promising results in preclinical models, making GAL8 a potential target for the development of new cancer treatments.
Furthermore, GAL8 has been studied in the context of infectious diseases. It has been found to play a role in viral infections, such as HIV and influenza, by interacting with viral glycoproteins. Targeting GAL8 may provide a new approach for preventing viral entry and replication.
In summary, Human Galectin 8 is a multifunctional protein with diverse activities in various biological processes. Its structure, consisting of a CRD and NLD, allows it to bind to specific carbohydrate structures and modulate cell adhesion, migration, and signaling. GAL8 has potential applications in the treatment of autoimmune diseases, cancer, and infectious diseases. Further research and development of GAL8 as a drug target may lead to new and effective treatments for these diseases.
Send us a message from the form below
Reviews
There are no reviews yet.