Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Galectin 8 (GAL8) recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O00214
Molecular weight:
60kDa

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Full-length Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Galectin 8 (GAL8) recombinant protein

Product name Human Galectin 8 (GAL8) recombinant protein
Uniprot ID O00214
Uniprot link http://www.uniprot.org/uniprot/O00214
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Molecular weight 60kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS8, PCTA1, Po66-CBP, Prostate Carcinoma Tumor Antigen 1, Lectin,Galactoside-Binding Soluble 8, Po66 carbohydrate-binding protein, Prostate carcinoma tumor antigen 1
Reference PX-P4019
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human Galectin 8 (GAL8) recombinant protein
Uniprot ID O00214
Uniprot link http://www.uniprot.org/uniprot/O00214
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Molecular weight 60kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS8, PCTA1, Po66-CBP, Prostate Carcinoma Tumor Antigen 1, Lectin,Galactoside-Binding Soluble 8, Po66 carbohydrate-binding protein, Prostate carcinoma tumor antigen 1
Reference PX-P4019
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P4019-1MG
Uniprot ID O00214
Uniprot link http://www.uniprot.org/uniprot/O00214
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Molecular weight 60kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms LGALS8, PCTA1, Po66-CBP, Prostate Carcinoma Tumor Antigen 1, Lectin,Galactoside-Binding Soluble 8, Po66 carbohydrate-binding protein, Prostate carcinoma tumor antigen 1
Reference PX-P4019
Note For research use only
Molecular Constructor
Full-length Yes

Human Galectin 8 (GAL8) recombinant protein

There are no reviews yet.

Be the first to review “Human Galectin 8 (GAL8) recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products