Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P16455
Molecular weight:
38.40 kDa

$587.00

100ug + 587 loyalty points
Unknown Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein

Product name MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes
Product name MGMT Protein - PelB-DN10-ST (virer PelB) Recombinant Protein
Uniprot ID P16455
Uniprot link http://www.uniprot.org/uniprot/P16455
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAGSEVQLVESGGGVVQPGDSLRLSCVASGRTDSIYSMAWFRQAPGKEREFVAIITWRREYTNYEDSVRGRFTISRDNAKNAVYLQMNKLKPEDTAVYYCALRPGLRDDLNYWGQGTQVTVSSGGSGGGSGGGSGGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWK
Molecular weight 38.40 kDa
Protein delivered with Tag? Yes
Purity estimated 10%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Unknown
Protein Accession AFU51890.1
Spec:Entrez GeneID 4255
Spec:SwissProtID P16455
NCBI Reference AFU51890.1
Aliases /Synonyms PelB-DN10-ST (virer PelB), O-6-methylguanine-DNA methyltransferase
Reference PX-P2087
Note For research use only
Molecular Constructor
Unknown Yes

Introduction

MGMT Protein, also known as O6-methylguanine-DNA methyltransferase, is a key enzyme involved in DNA repair. It plays a crucial role in protecting cells from DNA damage caused by alkylating agents, which are commonly used in chemotherapy treatments. However, the overexpression of MGMT Protein in cancer cells can lead to drug resistance, making it an attractive drug target for cancer therapy.

Structure of MGMT Protein

MGMT Protein is a 207 amino acid long protein with a molecular weight of approximately 23 kDa. It consists of two domains: the N-terminal DNA binding domain and the C-terminal catalytic domain. The N-terminal domain is responsible for recognizing and binding to damaged DNA, while the C-terminal domain is responsible for the enzymatic activity of MGMT Protein.

Activity of MGMT Protein

The primary function of MGMT Protein is to remove alkyl groups from the O6 position of guanine in DNA. This process, known as O6-alkylguanine DNA alkyltransferase, restores the integrity of the DNA and prevents mutations and cell death. MGMT Protein is able to repair a wide range of DNA lesions, making it a vital component of the DNA repair machinery.

Application of MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein

The PelB-DN10-ST (virer PelB) Recombinant Protein is a modified form of MGMT Protein that has been optimized for therapeutic use. It is produced using recombinant DNA technology and has been shown to have improved stability and activity compared to the native MGMT Protein.

One of the main applications of PelB-DN10-ST (virer PelB) Recombinant Protein is in cancer therapy. The overexpression of MGMT Protein in cancer cells is a major cause of resistance to alkylating agents, which are commonly used in chemotherapy. By using PelB-DN10-ST (virer PelB) Recombinant Protein, the activity of MGMT Protein can be selectively inhibited in cancer cells, making them more susceptible to the effects of chemotherapy. This approach has been shown to improve the efficacy of chemotherapy and overcome drug resistance in various types of cancer, including glioblastoma, colorectal cancer, and lung cancer.

In addition to its use in cancer therapy, PelB-DN10-ST (virer PelB) Recombinant Protein has also shown potential in the treatment of other diseases. Studies have shown that it can be used to enhance the effectiveness of radiotherapy, as well as protect against DNA damage caused by environmental toxins and oxidative stress. It has also been explored as a potential therapy for neurodegenerative disorders, such as Parkinson’s and Alzheimer’s disease, as well as autoimmune disorders, such as multiple sclerosis.

Conclusion

In conclusion, MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein is a promising drug target with a wide range of applications in cancer therapy and other diseases. Its unique ability to repair DNA damage and its potential to overcome drug resistance make it a valuable tool in the fight against cancer. With ongoing research and development, PelB-DN10-ST (virer PelB) Recombinant Protein has the potential to improve the effectiveness of current treatments and pave the way for new therapeutic strategies.

There are no reviews yet.

Be the first to review “MGMT Protein – PelB-DN10-ST (virer PelB) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products