Human CKMB recombinant protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameHuman CKMB recombinant protein
Uniprot IDCKM: P06732; CKB:P12277
Uniprot linkhttp://www.uniprot.org/uniprot/P06732 http://www.uniprot.org/uniprot/P12277
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceCKM Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGSAWSHPQFEK CKB Sequence: MGSHHHHHHSGPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Molecular weightCKM: 44.29kDa; CKB: 43.69kDa
Protein delivered with Tag?Yes
Purity estimated90%
Buffer50 mM Tris-HCl pH 8, 150 mM NaCl
FormLyophilized
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Aliases /SynonymsCreatine Kinase MB Isoenzyme Type-II, CKMBITII, CKMBI, CKMB, CKM, CKB, Human Creatine kinase M-type recombinant protein, Human Creatine kinase B-type recombinant protein
ReferencePX-P4053
NoteFor research use only

Description of Human CKMB recombinant protein

Introduction

Human CKMB recombinant protein is a type of protein that is produced in a laboratory using recombinant DNA technology. It is a modified form of the naturally occurring CKMB protein, which is found in the heart muscle and plays a crucial role in the regulation of cardiac function.

Structure of Human CKMB Recombinant Protein

The human CKMB recombinant protein is composed of two subunits, CKM and CKB, which are joined together by a disulfide bond. The CKM subunit is responsible for the catalytic activity of the protein, while the CKB subunit helps in stabilizing the structure of the protein. The overall structure of the protein is similar to that of the natural CKMB protein, making it highly effective in its function.

Activity of Human CKMB Recombinant Protein

The primary function of human CKMB recombinant protein is to regulate the activity of the enzyme creatine kinase, which is involved in the production of energy in the heart muscle. This protein specifically targets the CKMB isoform of creatine kinase, which is found exclusively in the heart tissue. By binding to and regulating the activity of this enzyme, the CKMB recombinant protein helps in maintaining the proper functioning of the heart.

In addition to its role in regulating creatine kinase, human CKMB recombinant protein also has anti-inflammatory properties. It has been found to inhibit the production of pro-inflammatory cytokines, which are responsible for causing inflammation in the body. This makes it a potential therapeutic agent for conditions such as myocarditis and other inflammatory diseases.

Application of Human CKMB Recombinant Protein

The most significant application of human CKMB recombinant protein is in the treatment of heart diseases. It is used as a drug target for conditions such as myocardial infarction, where the heart muscle is damaged due to a lack of blood supply. By regulating the activity of creatine kinase, this protein helps in reducing the damage to the heart muscle and promoting its repair.

Moreover, the anti-inflammatory properties of human CKMB recombinant protein make it a potential therapeutic agent for other heart diseases, such as myocarditis and cardiomyopathy. It has also shown promising results in the treatment of other inflammatory conditions, including rheumatoid arthritis and multiple sclerosis.

Future Possibilities

With ongoing research and advancements in recombinant DNA technology, there is a possibility of developing more targeted and efficient forms of human CKMB recombinant protein. This could lead to improved treatment options for heart diseases and other inflammatory conditions.

Conclusion

In summary, human CKMB recombinant protein is a highly effective protein that plays a crucial role in regulating heart function and has potential therapeutic applications in heart diseases and inflammatory conditions. Its structure, activity, and applications make it a promising drug target for the treatment of various diseases.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human CKMB recombinant protein”

Your email address will not be published. Required fields are marked *

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products