Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CKMB recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
CKM: P06732; CKB:P12277
Molecular weight:
CKM: 44.29kDa; CKB: 43.69kDa

$250.00

50ug + 250 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CKMB recombinant protein

Human CKMB recombinant protein

Product name Human CKMB recombinant protein
Uniprot ID CKM: P06732; CKB:P12277
Uniprot link http://www.uniprot.org/uniprot/P06732 http://www.uniprot.org/uniprot/P12277
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence CKM Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGSAWSHPQFEK CKB Sequence: MGSHHHHHHSGPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Molecular weight CKM: 44.29kDa; CKB: 43.69kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Creatine Kinase MB Isoenzyme Type-II, CKMBITII, CKMBI, CKMB, CKM, CKB, Human Creatine kinase M-type recombinant protein, Human Creatine kinase B-type recombinant protein
Reference PX-P4053
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human CKMB recombinant protein
Uniprot ID CKM: P06732; CKB:P12277
Uniprot link http://www.uniprot.org/uniprot/P06732 http://www.uniprot.org/uniprot/P12277
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence CKM Sequence: MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQKGSAWSHPQFEK CKB Sequence: MGSHHHHHHSGPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Molecular weight CKM: 44.29kDa; CKB: 43.69kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Aliases /Synonyms Creatine Kinase MB Isoenzyme Type-II, CKMBITII, CKMBI, CKMB, CKM, CKB, Human Creatine kinase M-type recombinant protein, Human Creatine kinase B-type recombinant protein
Reference PX-P4053
Note For research use only
Molecular Constructor
Full-length Yes

General Information about Human CKMB recombinant protein

Heterodimer comprised of Creatine kinase M type and Creatine kinase B-type

There are no reviews yet.

Be the first to review “Human CKMB recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products