Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human Golgi membrane protein 1 (GP73) recombinant protein |
---|---|
Uniprot ID | Q8NBJ4 |
Uniprot link | http://www.uniprot.org/uniprot/Q8NBJ4 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL |
Molecular weight | 42.35kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 80% |
Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Aliases /Synonyms | GOLM1, GOLPH2, C9orf155, Golgi Membrane Protein 1, Golgi Phosphoprotein 2, GP73 |
Reference | PX-P4051 |
Note | For research use only |
Golgi complex plays a key role in the ordering and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is the Golgi type II transmembrane protein. It processes the proteins synthesized in the rough endoplasmic reticulum and aids in the transport of the protein load through the Golgi apparatus. It has been observed that the expression of this gene is regulated by viral infection. Alternatively, an explicit transcription code encoding the same protein has been described for this gene.
Send us a message from the form below
Reviews
There are no reviews yet.