Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | size | 100ug, 20ug, 50ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Escherichia coli (E. coli) | 
| Applications | Elisa, WB | 
| Product name | Human IL22 Recombinant Protein | 
|---|---|
| Uniprot ID | Q9GZX6 | 
| Uniprot link | http://www.uniprot.org/uniprot/ Q9GZX6 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Prokaryotic expression | 
| Sequence | MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH | 
| Molecular weight | 18.04 kDa | 
| Protein delivered with Tag? | Yes | 
| Purity estimated | 90% | 
| Buffer | PBS,pH 7.5 urea +8M | 
| Form | Frozen | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 10-25 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Partial | 
| NCBI Reference | Q9GZX6 | 
| Aliases /Synonyms | ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor | 
| Reference | PX-P3032 | 
| Note | For research use only | 
Related products
Send us a message from the form below
Reviews
There are no reviews yet.