Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human IL22 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9GZX6
Molecular weight:
18.04 kDa

Original price was: $284.00.Current price is: $250.00.

50ug 12% OFF + 250 loyalty points
Partial Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human IL22 Recombinant Protein

Human IL22 Recombinant Protein

Product name Human IL22 Recombinant Protein
Uniprot ID Q9GZX6
Uniprot link http://www.uniprot.org/uniprot/ Q9GZX6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH
Molecular weight 18.04 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q9GZX6
Aliases /Synonyms ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor
Reference PX-P3032
Note For research use only
Molecular Constructor
Partial Yes
Product name Human IL22 Recombinant Protein
Uniprot ID Q9GZX6
Uniprot link http://www.uniprot.org/uniprot/ Q9GZX6
Origin species Homo sapiens (Human)
Expression system Procaryotic expression
Raw Antigen Sequence MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH
Molecular weight 18.04 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q9GZX6
Aliases /Synonyms ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor
Reference PX-P3032
Note For research use only
Molecular Constructor
Partial Yes
Product name Human IL22 Recombinant Protein
Uniprot ID Q9GZX6
Uniprot link http://www.uniprot.org/uniprot/ Q9GZX6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH
Molecular weight 18.04 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q9GZX6
Aliases /Synonyms ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor
Reference PX-P3032
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P3032-1MG
Uniprot ID Q9GZX6
Uniprot link http://www.uniprot.org/uniprot/ Q9GZX6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MVAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACILEHHHHHH
Molecular weight 18.04 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS,pH 7.5 urea +8M
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
NCBI Reference Q9GZX6
Aliases /Synonyms ILTIF, Zcyto18, IL-TIF, IL-D110, TIFa, TIFIL-23, IL-22, Cytokine Zcyto18, IL-10-Related T-Cell-Derived Inducible Factor
Reference PX-P3032
Note For research use only
Molecular Constructor
Partial Yes

Human IL22 Recombinant Protein

There are no reviews yet.

Be the first to review “Human IL22 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products