Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

Product name Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1232-50
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade is a novel antibody developed for the treatment of inflammatory diseases. This biosimilar is a monoclonal antibody that specifically targets interleukin-22 (IL-22), a cytokine involved in the pathogenesis of various inflammatory conditions. In this article, we will delve into the structure, activity, and potential applications of this promising therapeutic agent.

Structure of Fezakinumab Biosimilar

Fezakinumab Biosimilar is a biosimilar version of the original anti-IL22 monoclonal antibody, fezakinumab. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The heavy chains are linked together by disulfide bonds, while the light chains are connected to the heavy chains by non-covalent interactions. The antibody has a Y-shaped structure, with the antigen-binding sites located at the tips of the Y.

Mechanism of Action

Fezakinumab Biosimilar works by binding to IL-22 and preventing it from interacting with its receptors on target cells. IL-22 is a pro-inflammatory cytokine that plays a crucial role in the development and progression of various inflammatory diseases, such as psoriasis, rheumatoid arthritis, and inflammatory bowel disease. By blocking the IL-22 signaling pathway, Fezakinumab Biosimilar can reduce inflammation and alleviate symptoms associated with these conditions.

Applications

Fezakinumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various inflammatory diseases. It has been studied in psoriasis, atopic dermatitis, and rheumatoid arthritis, among others. In a phase 2 clinical trial, patients with moderate to severe psoriasis treated with fezakinumab showed significant improvement in their symptoms compared to those treated with placebo. Similarly, in a phase 2b study, patients with moderate to severe atopic dermatitis treated with fezakinumab experienced a significant reduction in disease severity compared to placebo.

Advantages of Fezakinumab Biosimilar

As a biosimilar, Fezakinumab Biosimilar offers several advantages over the original monoclonal antibody. Firstly, it is more cost-effective, making it more accessible to patients. Secondly, it has a similar safety and efficacy profile to the original drug, as demonstrated in clinical trials. Lastly, it has the potential to increase competition in the market, leading to lower prices and improved access to treatment for patients.

Future Directions

Fezakinumab Biosimilar is currently in the late stages of development and is expected to receive regulatory approval in the near future. With its potential to treat a wide range of inflammatory diseases, it has the potential to become a valuable addition to the current treatment options available. Further studies are needed to fully understand its efficacy and safety profile, as well as its potential use in combination with other therapies.

Conclusion

In summary, Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade is a promising therapeutic agent for the treatment of inflammatory diseases. Its unique mechanism of action, cost-effectiveness, and potential applications make it a valuable addition to the current treatment options available. With further research and development, it has the potential to improve the lives of patients suffering from various inflammatory conditions.

SDS-PAGE for Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

SDS-PAGE for Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products