Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade

  • PX-TA1701-50
  • Validated FC WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Product name Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1,Kappa
Clonality Monoclonal Antibody
Product name PX-TA1701-50
Uniprot ID Q04609
Source CAS
Species Homo sapiens
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pelgifatamab,PELGIFATAMAB,FOLH1,anti-FOLH1
Reference PX-TA1701
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade

Pelgifatamab Biosimilar is a monoclonal antibody (mAb) that specifically targets the protein FOLH1, also known as prostate-specific membrane antigen (PSMA). This biosimilar is a highly active and potent therapeutic agent that has shown promising results in the treatment of various cancers, particularly prostate cancer. In this article, we will delve into the structure, activity, and application of Pelgifatamab Biosimilar in detail.

Structure of Pelgifatamab Biosimilar

Pelgifatamab Biosimilar is a fully humanized IgG1 monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy chains consist of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The VH and VL regions together form the antigen-binding site, which is responsible for the specific binding of Pelgifatamab Biosimilar to FOLH1.

Activity of Pelgifatamab Biosimilar

Pelgifatamab Biosimilar binds to FOLH1 with high affinity and specificity, making it a potent therapeutic agent. FOLH1 is overexpressed in several types of cancer, including prostate, bladder, and renal cell carcinoma, making it an attractive therapeutic target. Upon binding to FOLH1, Pelgifatamab Biosimilar triggers a series of immune-mediated processes that lead to the destruction of cancer cells. These include antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and induction of apoptosis.

Application of Pelgifatamab Biosimilar

Pelgifatamab Biosimilar has shown promising results in preclinical and clinical studies as a potential treatment for various cancers. In particular, it has shown significant anti-tumor activity in patients with metastatic castration-resistant prostate cancer (mCRPC) who have failed previous treatments. In a phase 2 clinical trial, Pelgifatamab Biosimilar showed a 66% reduction in prostate-specific antigen (PSA) levels in patients with mCRPC, and 84% of patients experienced a decrease in circulating tumor cells. These results demonstrate the potential of Pelgifatamab Biosimilar as a targeted therapy for prostate cancer.

Advantages of Pelgifatamab Biosimilar

One of the major advantages of Pelgifatamab Biosimilar is its high specificity for FOLH1, which minimizes the risk of off-target effects. Additionally, being a fully humanized antibody, it has a reduced risk of immunogenicity, making it a safe and well-tolerated treatment option. Moreover, Pelgifatamab Biosimilar has a long half-life, allowing for less frequent dosing and better patient compliance.

Future Directions for Pelgifatamab Biosimilar The potential of Pelgifatamab Biosimilar goes beyond prostate

cancer. FOLH1 is also overexpressed in other types of cancer, such as bladder and renal cell carcinoma, making Pelgifatamab Biosimilar a promising candidate for the treatment of these diseases. Furthermore, ongoing research is exploring the combination of Pelgifatamab Biosimilar with other treatments, such as chemotherapy and immunotherapy, to enhance its therapeutic efficacy.

In conclusion, Pelgifatamab Biosimilar is a highly active and potent monoclonal antibody that specifically targets FOLH1, a protein overexpressed in various types of cancer. Its unique structure and mechanism of action make it a promising therapeutic option for the treatment of prostate cancer and potentially other cancers as well. With ongoing research and clinical trials, Pelgifatamab Biosimilar holds great potential to improve the lives of cancer patients in the future.

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow-cytometry using PE anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an PE anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1701, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow Cytometry results for Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

Flow-cytometry using FITC anti-human FOLH1 antibody. LNCAP cells were stained with an irrelevant antibody (Blue Histogram) or an FITC anti-human FOLH1 monoclonal antibody (Catalog: PX-TA1701, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, and cells analysed on a NovoCyte Flow Cytometer.

Pelgifatamab Biosimilar - Anti-FOLH1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Pelgifatamab Biosimilar – Anti-FOLH1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products