Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FOLH1-PSMA recombinant protein

Host species:
Insect
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q04609
Molecular weight:
86.36 kDa

$500.00

100ug + 500 loyalty points
Strep Lys44–Ala750
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FOLH1-PSMA recombinant protein

Product name Human FOLH1-PSMA recombinant protein
Uniprot ID Q04609
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Molecular weight 86.36 kDa
Protein delivered with Tag? N-Terminal Strep Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Lys44-Ala750
Aliases /Synonyms NAALAD1, Prostate-specific membrane antigen, NAALADase I, PSMA, PSM, Pteroylpoly-gamma-glutamate carboxypeptidase, Glutamate carboxypeptidase 2, N-acetylated-alpha-linked acidic dipeptidase I, Glutamate carboxypeptidase II, FOLH1, FGCP, FOLH, Folylpoly-gamma-glutamate carboxypeptidase, Folate hydrolase 1, GCPII, Membrane glutamate carboxypeptidase, Cell growth-inhibiting gene 27 protein, mGCP, Drug Target
Reference PX-P6122
Note For research use only
Molecular Constructor
Strep Lys44–Ala750

Human FOLH1-PSMA recombinant protein

There are no reviews yet.

Be the first to review “Human FOLH1-PSMA recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products